mTOR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11355S
Artikelname: mTOR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11355S
Hersteller Artikelnummer: CNA11355S
Alternativnummer: MBL-CNA11355S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human mTOR (NP_004949.1).
Konjugation: Unconjugated
Alternative Synonym: SKS, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Klonalität: Polyclonal
Molekulargewicht: 289kDa
NCBI: 2475
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
Target-Kategorie: MTOR
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200