ACE1 Rabbit mAb, Clone: [ARC0577], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11357S
Artikelname: ACE1 Rabbit mAb, Clone: [ARC0577], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11357S
Hersteller Artikelnummer: CNA11357S
Alternativnummer: MBL-CNA11357S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1200-1306 of human ACE1 (P12821).
Konjugation: Unconjugated
Alternative Synonym: DCP, ACE1, DCP1, CD143
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0577]
Molekulargewicht: 150kDa
NCBI: 1636
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS
Target-Kategorie: ACE
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000