GSK3beta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11360T
Artikelname: GSK3beta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11360T
Hersteller Artikelnummer: CNA11360T
Alternativnummer: MBL-CNA11360T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 321-420 of human GSK3beta (NP_001139628.1).
Konjugation: Unconjugated
Alternative Synonym: GSK3B,gsk-3beta
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 2932
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Target-Kategorie: GSK3B
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200