Myoglobin Rabbit mAb, Clone: [ARC0582], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11368S
Artikelname: Myoglobin Rabbit mAb, Clone: [ARC0582], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11368S
Hersteller Artikelnummer: CNA11368S
Alternativnummer: MBL-CNA11368S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144).
Konjugation: Unconjugated
Alternative Synonym: MYOSB, PVALB
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0582]
Molekulargewicht: 17kDa
NCBI: 4151
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Target-Kategorie: MB
Application Verdünnung: WB: WB,1:500 - 1:2000