c-Jun Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11378P
Artikelname: c-Jun Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11378P
Hersteller Artikelnummer: CNA11378P
Alternativnummer: MBL-CNA11378P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Jun (NP_002219.1).
Konjugation: Unconjugated
Alternative Synonym: AP1, p39, AP-1, cJUN, c-Jun
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 3725
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCP
Target-Kategorie: JUN
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200