CD47 Rabbit mAb, Clone: [ARC0584], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11382S
Artikelname: CD47 Rabbit mAb, Clone: [ARC0584], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11382S
Hersteller Artikelnummer: CNA11382S
Alternativnummer: MBL-CNA11382S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (Q08722).
Konjugation: Unconjugated
Alternative Synonym: IAP, OA3, MER6
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0584]
Molekulargewicht: 35kDa
NCBI: 961
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE
Target-Kategorie: CD47
Application Verdünnung: WB: WB,1:500 - 1:1000