delta-Catenin/p120 Catenin Rabbit mAb, Clone: [ARC0586], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11399S
Artikelname: delta-Catenin/p120 Catenin Rabbit mAb, Clone: [ARC0586], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11399S
Hersteller Artikelnummer: CNA11399S
Alternativnummer: MBL-CNA11399S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 869-968 of human delta-Catenin/p120 Catenin (O60716).
Konjugation: Unconjugated
Alternative Synonym: CAS, p120, BCDS2, CTNND, P120CAS, P120CTN, p120(CAS), p120(CTN)
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0586]
Molekulargewicht: 108kDa
NCBI: 1500
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
Target-Kategorie: CTNND1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000