PI3 Kinase p85 alpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11402T
Artikelname: PI3 Kinase p85 alpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11402T
Hersteller Artikelnummer: CNA11402T
Alternativnummer: MBL-CNA11402T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 240-380 of human PI3 Kinase p85 alpha (NP_852556.2).
Konjugation: Unconjugated
Alternative Synonym: p85, AGM7, GRB1, IMD36, p85alpha, p85-ALPHA
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 5295
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRE
Target-Kategorie: PIK3R1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200