BMP4 Rabbit mAb, Clone: [ARC0587], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11405S
Artikelname: BMP4 Rabbit mAb, Clone: [ARC0587], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11405S
Hersteller Artikelnummer: CNA11405S
Alternativnummer: MBL-CNA11405S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 309-408 of human BMP4 (P12644).
Konjugation: Unconjugated
Alternative Synonym: ZYME, BMP2B, OFC11, BMP2B1, MCOPS6
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0587]
Molekulargewicht: 47kDa
NCBI: 652
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Target-Kategorie: BMP4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200