Histone H2AX Rabbit mAb, Clone: [ARC0590], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11412S
Artikelname: Histone H2AX Rabbit mAb, Clone: [ARC0590], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11412S
Hersteller Artikelnummer: CNA11412S
Alternativnummer: MBL-CNA11412S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2AX (P16104).
Konjugation: Unconjugated
Alternative Synonym: H2A.X, H2A/X, H2AFX
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0590]
Molekulargewicht: 15kDa
NCBI: 3014
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGG
Target-Kategorie: H2AX
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ChIP,1:50 - 1:200