CDK1 Rabbit mAb, Clone: [ARC50607], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11420P
Artikelname: CDK1 Rabbit mAb, Clone: [ARC50607], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11420P
Hersteller Artikelnummer: CNA11420P
Alternativnummer: MBL-CNA11420P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 198-297 of human CDK1 (NP_001777.1).
Konjugation: Unconjugated
Alternative Synonym: CDC2, CDC28A, P34CDC2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50607]
Molekulargewicht: 34kDa
NCBI: 983
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Target-Kategorie: CDK1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000