Vimentin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11423T
Artikelname: Vimentin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11423T
Hersteller Artikelnummer: CNA11423T
Alternativnummer: MBL-CNA11423T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Vimentin (NP_003371.2).
Konjugation: Unconjugated
Alternative Synonym: CTRCT30,HEL113,Vimentin,VIM,vimentin
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 7431
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATY
Target-Kategorie: VIM
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200