YAP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11430S
Artikelname: YAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11430S
Hersteller Artikelnummer: CNA11430S
Alternativnummer: MBL-CNA11430S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human YAP1 (NP_001123617.1).
Konjugation: Unconjugated
Alternative Synonym: YAP, YKI, COB1, YAP2, YAP-1, YAP65
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 10413
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPG
Target-Kategorie: YAP1
Application Verdünnung: WB: WB,1:500 - 1:2000