DNA Ligase IV Rabbit mAb, Clone: [ARC0595], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11432S
Artikelname: DNA Ligase IV Rabbit mAb, Clone: [ARC0595], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11432S
Hersteller Artikelnummer: CNA11432S
Alternativnummer: MBL-CNA11432S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 504-685 of human DNA Ligase IV (P49917).
Konjugation: Unconjugated
Alternative Synonym: LIG4S
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0595]
Molekulargewicht: 104kDa
NCBI: 3981
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILCGTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLEQLRGKASGKLASKHLYIGGDDEPQEKKRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFEDVEFCVMSGTDSQPKPDLENRIAEF
Target-Kategorie: LIG4
Application Verdünnung: WB: WB,1:500 - 1:2000