ASC/TMS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11433T
Artikelname: ASC/TMS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11433T
Hersteller Artikelnummer: CNA11433T
Alternativnummer: MBL-CNA11433T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-50 of human ASC/TMS1 (NP_037390.2).
Konjugation: Unconjugated
Alternative Synonym: ASC, TMS, TMS1, CARD5, TMS-1
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 29108
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDAL
Target-Kategorie: PYCARD
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200