MAP1LC3A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11438S
Artikelname: MAP1LC3A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11438S
Hersteller Artikelnummer: CNA11438S
Alternativnummer: MBL-CNA11438S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (NP_115903.1).
Konjugation: Unconjugated
Alternative Synonym: LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 84557
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Target-Kategorie: MAP1LC3A
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200