GCLM Rabbit mAb, Clone: [ARC0597], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11444S
Artikelname: GCLM Rabbit mAb, Clone: [ARC0597], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11444S
Hersteller Artikelnummer: CNA11444S
Alternativnummer: MBL-CNA11444S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507).
Konjugation: Unconjugated
Alternative Synonym: GLCLR
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0597]
Molekulargewicht: 31kDa
NCBI: 2730
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
Target-Kategorie: GCLM
Application Verdünnung: WB: WB,1:500 - 1:1000