Caspase-8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11450T
Artikelname: Caspase-8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11450T
Hersteller Artikelnummer: CNA11450T
Alternativnummer: MBL-CNA11450T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Caspase-8 (NP_203519.1).
Konjugation: Unconjugated
Alternative Synonym: CAP4, MACH, MCH5, FLICE, ALPS2B, Casp-8
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 841
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFL
Target-Kategorie: CASP8
Application Verdünnung: WB: WB,1:500 - 1:1000