DAP Kinase 1 (DAPK1) Rabbit mAb, Clone: [ARC0601], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11459S
Artikelname: DAP Kinase 1 (DAPK1) Rabbit mAb, Clone: [ARC0601], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11459S
Hersteller Artikelnummer: CNA11459S
Alternativnummer: MBL-CNA11459S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355).
Konjugation: Unconjugated
Alternative Synonym: DAPK, ROCO3
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0601]
Molekulargewicht: 160kDa
NCBI: 1612
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH
Target-Kategorie: DAPK1
Application Verdünnung: WB: WB,1:500 - 1:1000