ADAR1 Rabbit mAb, Clone: [ARC0602], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11466S
Artikelname: ADAR1 Rabbit mAb, Clone: [ARC0602], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11466S
Hersteller Artikelnummer: CNA11466S
Alternativnummer: MBL-CNA11466S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human ADAR1 (P55265).
Konjugation: Unconjugated
Alternative Synonym: DSH, AGS6, G1P1, IFI4, P136, ADAR1, DRADA, DSRAD, IFI-4, K88DSRBP
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0602]
Molekulargewicht: 136kDa
NCBI: 103
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: STQAWNQHSGVVRPDGHSQGAPNSDPSLEPEDRNSTSVSEDLLEPFIAVSAQAWNQHSGVVRPDSHSQGSPNSDPGLEPEDSNSTSALEDPLEFLDMAEIK
Target-Kategorie: ADAR
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200