MAD2/MAD2L1 Rabbit mAb, Clone: [ARC0603], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11469S
Artikelname: MAD2/MAD2L1 Rabbit mAb, Clone: [ARC0603], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11469S
Hersteller Artikelnummer: CNA11469S
Alternativnummer: MBL-CNA11469S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257).
Konjugation: Unconjugated
Alternative Synonym: MAD2, HSMAD2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0603]
Molekulargewicht: 24kDa
NCBI: 4085
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS
Target-Kategorie: MAD2L1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200