Smad3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11471S
Artikelname: Smad3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11471S
Hersteller Artikelnummer: CNA11471S
Alternativnummer: MBL-CNA11471S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Smad3 (NP_005893.1).
Konjugation: Unconjugated
Alternative Synonym: LDS3, mad3, LDS1C, MADH3, JV15-2, hMAD-3, hSMAD3, HSPC193, HsT17436
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 4088
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: FPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA
Target-Kategorie: SMAD3
Application Verdünnung: WB: WB,1:500 - 1:2000