ATOH1 Rabbit mAb, Clone: [ARC0609], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11477S
Artikelname: ATOH1 Rabbit mAb, Clone: [ARC0609], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11477S
Hersteller Artikelnummer: CNA11477S
Alternativnummer: MBL-CNA11477S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH1 (Q92858).
Konjugation: Unconjugated
Alternative Synonym: ATH1, HATH1, DFNA89, MATH-1, bHLHa14
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0609]
Molekulargewicht: 38kDa
NCBI: 474
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVD
Target-Kategorie: ATOH1
Application Verdünnung: WB: WB,1:500 - 1:1000