CES1 Rabbit mAb, Clone: [ARC0613], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11478S
Artikelname: CES1 Rabbit mAb, Clone: [ARC0613], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11478S
Hersteller Artikelnummer: CNA11478S
Alternativnummer: MBL-CNA11478S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CES1 (P23141).
Konjugation: Unconjugated
Alternative Synonym: CEH, REH, TGH, ACAT, CE-1, CES2, HMSE, SES1, HMSE1, PCE-1, hCE-1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0613]
Molekulargewicht: 63kDa
NCBI: 1066
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
Target-Kategorie: CES1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200