NEUROD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1147P
Artikelname: NEUROD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1147P
Hersteller Artikelnummer: CNA1147P
Alternativnummer: MBL-CNA1147P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-356 of human NEUROD1 (NP_002491.3).
Konjugation: Unconjugated
Alternative Synonym: T2D, BETA2, BHF-1, MODY6, NEUROD, bHLHa3
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 4760
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Target-Kategorie: NEUROD1
Application Verdünnung: WB: WB,1:100 - 1:500