Mast Cell Chymase (CMA1) Rabbit mAb, Clone: [ARC0614], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11480S
Artikelname: Mast Cell Chymase (CMA1) Rabbit mAb, Clone: [ARC0614], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11480S
Hersteller Artikelnummer: CNA11480S
Alternativnummer: MBL-CNA11480S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Mast Cell Chymase (CMA1) (CMA1) (P23946).
Konjugation: Unconjugated
Alternative Synonym: CYH, MCT1, chymase
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0614]
Molekulargewicht: 27kDa
NCBI: 1215
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Target-Kategorie: CMA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200