[KO Validated] FGF2 Rabbit mAb, Clone: [ARC0618], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11488S
Artikelname: [KO Validated] FGF2 Rabbit mAb, Clone: [ARC0618], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11488S
Hersteller Artikelnummer: CNA11488S
Alternativnummer: MBL-CNA11488S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5).
Konjugation: Unconjugated
Alternative Synonym: BFGF, FGFB, FGF-2, HBGF-2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0618]
Molekulargewicht: 31kDa
NCBI: 2247
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
Target-Kategorie: FGF2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200