CD41/ITGA2B Rabbit mAb, Clone: [ARC0620], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11490S
Artikelname: CD41/ITGA2B Rabbit mAb, Clone: [ARC0620], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11490S
Hersteller Artikelnummer: CNA11490S
Alternativnummer: MBL-CNA11490S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD41/ITGA2B (P08514).
Konjugation: Unconjugated
Alternative Synonym: GT, GT1, GTA, CD41, GP2B, HPA3, CD41B, GPIIb, BDPLT2, BDPLT16, PPP1R93
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0620]
Molekulargewicht: 113kDa
NCBI: 3674
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLL
Target-Kategorie: ITGA2B
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200