CELF1 Rabbit mAb, Clone: [ARC1866], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA1150S
Artikelname: CELF1 Rabbit mAb, Clone: [ARC1866], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA1150S
Hersteller Artikelnummer: CNA1150S
Alternativnummer: MBL-CNA1150S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CELF1 (Q92879).
Konjugation: Unconjugated
Alternative Synonym: CUGBP, NAB50, NAPOR, CUG-BP, CUGBP1, hNab50, BRUNOL2, EDEN-BP
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1866]
Molekulargewicht: 52kDa
NCBI: 10658
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE
Target-Kategorie: CELF1
Application Verdünnung: WB: WB,1:500 - 1:2000