beta-Catenin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11512P
Artikelname: beta-Catenin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11512P
Hersteller Artikelnummer: CNA11512P
Alternativnummer: MBL-CNA11512P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta-Catenin (NP_001895.1).
Konjugation: Unconjugated
Alternative Synonym: EVR7, CTNNB, MRD19, NEDSDV, armadillo
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 1499
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
Target-Kategorie: CTNNB1
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:20 - 1:200|IP,1:500 - 1:1000