MTCO2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11522S
Artikelname: MTCO2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11522S
Hersteller Artikelnummer: CNA11522S
Alternativnummer: MBL-CNA11522S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse MTCO2 (NP_904331.1).
Konjugation: Unconjugated
Alternative Synonym: COX2
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 17709
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEIC
Target-Kategorie: mt-Co2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500