CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11525T
Artikelname: CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11525T
Hersteller Artikelnummer: CNA11525T
Alternativnummer: MBL-CNA11525T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human CD31/PECAM (NP_000433.4).
Konjugation: Unconjugated
Alternative Synonym: CD31, PECA1, GPIIA, PECAM-1, endoCAM, CD31/EndoCAM
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 5175
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNE
Target-Kategorie: PECAM1
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:200