RRM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1152S
Artikelname: RRM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1152S
Hersteller Artikelnummer: CNA1152S
Alternativnummer: MBL-CNA1152S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 593-792 of human RRM1 (NP_001024.1).
Konjugation: Unconjugated
Alternative Synonym: R1, RR1, RIR1
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 6240
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Target-Kategorie: RRM1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000