[KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb, Clone: [ARC50558], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11532P
Artikelname: [KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb, Clone: [ARC50558], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11532P
Hersteller Artikelnummer: CNA11532P
Alternativnummer: MBL-CNA11532P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).
Konjugation: Unconjugated
Alternative Synonym: FH3, PC9, FHCL3, NARC1, LDLCQ1, NARC-1, HCHOLA3
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50558]
Molekulargewicht: 74kDa
NCBI: 255738
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
Target-Kategorie: PCSK9
Application Verdünnung: WB: WB,1:500 - 1:1000