BACE1 Rabbit mAb, Clone: [ARC0696], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11533S
Artikelname: BACE1 Rabbit mAb, Clone: [ARC0696], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11533S
Hersteller Artikelnummer: CNA11533S
Alternativnummer: MBL-CNA11533S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 402-501 of human BACE1 (P56817).
Konjugation: Unconjugated
Alternative Synonym: ASP2, BACE, HSPC104
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0696]
Molekulargewicht: 56kDa
NCBI: 23621
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: FYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK
Target-Kategorie: BACE1
Application Verdünnung: WB: WB,1:500 - 1:2000