[KO Validated] Bax Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11550S
Artikelname: [KO Validated] Bax Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11550S
Hersteller Artikelnummer: CNA11550S
Alternativnummer: MBL-CNA11550S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Bax (NP_620116.1).
Konjugation: Unconjugated
Alternative Synonym: BCL2L4
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 581
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Target-Kategorie: BAX
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000