[KO Validated] RhoGDI Rabbit mAb, Clone: [ARC0629], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11556S
Artikelname: [KO Validated] RhoGDI Rabbit mAb, Clone: [ARC0629], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11556S
Hersteller Artikelnummer: CNA11556S
Alternativnummer: MBL-CNA11556S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565).
Konjugation: Unconjugated
Alternative Synonym: GDIA1, NPHS8, RHOGDI, RHOGDI-1, HEL-S-47e
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0629]
Molekulargewicht: 23kDa
NCBI: 396
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG
Target-Kategorie: ARHGDIA
Application Verdünnung: WB: WB,1:500 - 1:1000