Glutathione Synthetase (GSS) Rabbit mAb, Clone: [ARC0630], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11557S
Artikelname: Glutathione Synthetase (GSS) Rabbit mAb, Clone: [ARC0630], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11557S
Hersteller Artikelnummer: CNA11557S
Alternativnummer: MBL-CNA11557S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Glutathione Synthetase (GSS) (P48637).
Konjugation: Unconjugated
Alternative Synonym: GSHS, HEL-S-64p, HEL-S-88n
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0630]
Molekulargewicht: 52kDa
NCBI: 2937
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: AIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR
Target-Kategorie: GSS
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200