Calreticulin Rabbit mAb, Clone: [ARC0632], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11563P
Artikelname: Calreticulin Rabbit mAb, Clone: [ARC0632], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11563P
Hersteller Artikelnummer: CNA11563P
Alternativnummer: MBL-CNA11563P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1).
Konjugation: Unconjugated
Alternative Synonym: RO, CRT, SSA, cC1qR, HEL-S-99n
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0632]
Molekulargewicht: 47kDa
NCBI: 811
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL
Target-Kategorie: CALR
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:100 - 1:500|IP,1:500 - 1:1000