hnRNP A1 Rabbit mAb, Clone: [ARC0633], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11564S
Artikelname: hnRNP A1 Rabbit mAb, Clone: [ARC0633], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11564S
Hersteller Artikelnummer: CNA11564S
Alternativnummer: MBL-CNA11564S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human hnRNP A1 (P09651).
Konjugation: Unconjugated
Alternative Synonym: UP 1, ALS19, ALS20, HNRPA1, IBMPFD3, HNRPA1L3, hnRNP A1, hnRNP-A1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0633]
Molekulargewicht: 39kDa
NCBI: 3178
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAK
Target-Kategorie: HNRNPA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000