CHD4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11574S
Artikelname: CHD4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11574S
Hersteller Artikelnummer: CNA11574S
Alternativnummer: MBL-CNA11574S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1690 of human CHD4 (NP_001264.2).
Konjugation: Unconjugated
Alternative Synonym: CHD-4, Mi-2b, SIHIWES, Mi2-BETA
Klonalität: Polyclonal
Molekulargewicht: 218kDa
NCBI: 1108
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKK
Target-Kategorie: CHD4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200