EGFR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11575S
Artikelname: EGFR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11575S
Hersteller Artikelnummer: CNA11575S
Alternativnummer: MBL-CNA11575S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 960-1060 of human EGFR (NP_005219.2).
Konjugation: Unconjugated
Alternative Synonym: ERBB, ERRP, HER1, mENA, ERBB1, PIG61, NISBD2
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 1956
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPI
Target-Kategorie: EGFR
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200