GSK3beta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11578S
Artikelname: GSK3beta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11578S
Hersteller Artikelnummer: CNA11578S
Alternativnummer: MBL-CNA11578S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human GSK3beta (NP_001139628.1).
Konjugation: Unconjugated
Alternative Synonym: GSK3B,gsk-3beta
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 2932
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Target-Kategorie: GSK3B
Application Verdünnung: WB: WB,1:500 - 1:2000