BCL3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11582T
Artikelname: BCL3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11582T
Hersteller Artikelnummer: CNA11582T
Alternativnummer: MBL-CNA11582T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human BCL3 (NP_005169.2).
Konjugation: Unconjugated
Alternative Synonym: BCL4, D19S37
Klonalität: Polyclonal
Molekulargewicht: 48kDa
NCBI: 602
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
Target-Kategorie: BCL3
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200