MAP3K14 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11585P
Artikelname: MAP3K14 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11585P
Hersteller Artikelnummer: CNA11585P
Alternativnummer: MBL-CNA11585P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 330-662 of human MAP3K14 (NP_003945.2).
Konjugation: Unconjugated
Alternative Synonym: HS, NIK, HSNIK, FTDCR1B
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 9020
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: KFSVEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSC
Target-Kategorie: MAP3K14
Application Verdünnung: WB: WB,1:100 - 1:500