HEPACAM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11589T
Artikelname: HEPACAM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11589T
Hersteller Artikelnummer: CNA11589T
Alternativnummer: MBL-CNA11589T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-245 of human HEPACAM (NP_689935.2).
Konjugation: Unconjugated
Alternative Synonym: HEPN1, MLC2A, MLC2B, GlialCAM
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 220296
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NITSPVRLIHGTVGKSALLSVQYSSTSSDRPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTVLELSEAFTLNCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKVLTITRVLMEDDDLYSCMVENPISQGRSLPVKITVYRRSSLYIIL
Target-Kategorie: HEPACAM
Application Verdünnung: WB: WB,1:500 - 1:2000