Bcl-W Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1158P
Artikelname: Bcl-W Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1158P
Hersteller Artikelnummer: CNA1158P
Alternativnummer: MBL-CNA1158P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bcl-W (NP_004041.2).
Konjugation: Unconjugated
Alternative Synonym: BCLW, BCL-W, PPP1R51, BCL2-L-2
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 599
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
Target-Kategorie: BCL2L2
Application Verdünnung: WB: WB,1:500 - 1:1000