ICT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA11590T
| Artikelname: |
ICT1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA11590T |
| Hersteller Artikelnummer: |
CNA11590T |
| Alternativnummer: |
MBL-CNA11590T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 30-206 of human ICT1 (NP_001536.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
DS1, DS-1, ICT1, MRP-L58 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
24kDa |
| NCBI: |
3396 |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD |
| Target-Kategorie: |
MRPL58 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
