Lumican (LUM) Rabbit mAb, Clone: [ARC0637], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA11593S
Artikelname: Lumican (LUM) Rabbit mAb, Clone: [ARC0637], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA11593S
Hersteller Artikelnummer: CNA11593S
Alternativnummer: MBL-CNA11593S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 212-350 of human Lumican (LUM) (P51884).
Konjugation: Unconjugated
Alternative Synonym: LDC, SLRR2D
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0637]
Molekulargewicht: 38kDa
NCBI: 4060
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Target-Kategorie: LUM
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200