GREM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA11595T
Artikelname: GREM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA11595T
Hersteller Artikelnummer: CNA11595T
Alternativnummer: MBL-CNA11595T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 44-143 of human GREM1 (NP_001178252.1).
Konjugation: Unconjugated
Alternative Synonym: DRM, HMPS, MPSH, PIG2, CRAC1, CRCS4, DAND2, HMPS1, IHG-2, DUP15q, C15DUPq, GREMLIN, CKTSF1B1
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 26585
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPRHIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD
Target-Kategorie: GREM1
Application Verdünnung: WB: WB,1:500 - 1:2000